Welcome to NewlyOpened! We help you discover new restaurants in Dufferin County. Don't forget to bookmark NewlyOpened to stay updated on new openings!

See all new restaurants in Dufferin County.
Subway
Loading photos...

Subway

Sandwich shop
3.9(246 reviews)
Closed
Today's hours: 8 AM - 10 PM

Subway is a new restaurant in Dufferin County opened more than 6 months ago.

Your local Primrose Subway® Restaurant, located at 635717 Highway brings new bold flavors along with old favorites to satisfied guests every day. We deliver these mouth-watering flavors with our famous Footlongs, 6” sandwiches, wraps and salads. And we offer a variety of ways to order—quick and easy in the app or online, convenient delivery, come into your neighborhood shop for an in-restaurant meal, or pick up curbside. We’re proud to offer a change from same old fast food with fresh cut veggies and toppings with protein choices, fresh-baked bread and let’s not forget cookies! And we’re happy to help you with any catering needs as well. All Subway® Restaurants are independently owned and operated by business owners who employ talented S...

Loading photos...

Location

635717 ON-10, Primrose, ON L0N 1S8



Features

Service options

DeliveryTakeoutDine-in

Accessibility

Wheelchair accessible seatingWheelchair-accessible entranceWheelchair-accessible parking lotWheelchair-accessible washroom

Frequently mentioned about

pricesveggiespoliteuncledrivingnapkinsfridayhygienicskillsfoot

Featured User Reviews

Terrible customer service. What’s the point in contactless delivery if the restaurant is going to blame you for not confronting the driver for missing items?? (Even though you called him immediately)

November 6, 2024 on Google

clean store, polite, fast, and they build a great sub

October 30, 2024 on Google

Stale food. Unprofessional Staff. Old uncle is damn rude. Bad attitude of girl at front. Grill is not working. They have bad washrooms ever.

June 30, 2024 on Google

We got Bad service. They don’t know how to talk to customers so rude. Never come again to this location. Old uncle ( employee ), he is very rude.

June 2, 2024 on Google

It was not the best-looking place, but the food was made so well! Staff was trying hard, but did not seem to be able to move fast. But did listen well.

May 26, 2024 on Google

Washrooms extremely dirty. Tons of thick black mold all around taps and around tops of toilets. Soap dispenser not clean to touch. Stay away.

May 17, 2024 on Google

Just came here to order and i asked them to put a foot long worths meat on a six inch and they only put the amount for six inch but still charged me for a foot long.. i understand it was a mistake but it’s already hard enough to make money these days but at least i should be able to get my moneys worth of food

April 21, 2024 on Google

Convenient location however, facilities plus customer service could improve.

September 5, 2021 on Google